Lineage for d3fx6a_ (3fx6 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2466053Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2466054Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 protein domains)
  6. 2466055Protein Carboxypeptidase A [53189] (4 species)
  7. 2466058Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2466096Domain d3fx6a_: 3fx6 A: [176125]
    automated match to d1arla_
    complexed with bpx, zn

Details for d3fx6a_

PDB Entry: 3fx6 (more details), 1.85 Å

PDB Description: x-ray crystallographic studies on the complex of carboxypeptidase a with the inhibitor using alpha-nitro ketone as the zinc-binding group
PDB Compounds: (A:) Carboxypeptidase A1

SCOPe Domain Sequences for d3fx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fx6a_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOPe Domain Coordinates for d3fx6a_:

Click to download the PDB-style file with coordinates for d3fx6a_.
(The format of our PDB-style files is described here.)

Timeline for d3fx6a_: