SCOPe 2.06: Domain d3fx4a_: 3fx4 A:

Lineage for d3fx4a_ (3fx4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)

8. Domain d3fx4a_: 3fx4 A: [176122]
   automated match to d1ae4a_
   protein/RNA complex; complexed with fx4, nap, so4

Details for d3fx4a_

PDB Entry: 3fx4, 1.99 Å

PDB Description: porcine aldehyde reductase in ternary complex with inhibitor

PDB Compounds: (A:) Alcohol dehydrogenase [NADP+]

SCOPe Domain Sequences for d3fx4a_:

Sequence; same for both SEQRES and ATOM records:

>d3fx4a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
maascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigeal
qetvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafer
gdnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrp
avlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaek
ynrspaqillrwqvqrkvicipksvtpsrilqniqvfdftfspeemkqldalnknlrfiv
pmltvdgkrvprdaghplypfndpy

Timeline for d3fx4a_:

• d3fx4a_ first appeared in SCOPe 2.01
  
• d3fx4a_ appears in SCOPe 2.05
  
• d3fx4a_ appears in SCOPe 2.07
  
• d3fx4a_ appears in the current release, SCOPe 2.08