SCOP 1.65: Domain d3gtub1: 3gtu B:85-224

Lineage for d3gtub1 (3gtu B:85-224)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries)

8. Domain d3gtub1: 3gtu B:85-224 [17612]
   Other proteins in same PDB: d3gtua2, d3gtub2, d3gtuc2, d3gtud2

Details for d3gtub1

PDB Entry: 3gtu, 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d3gtub1:

Sequence; same for both SEQRES and ATOM records:

>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens)}
rkhnmcgeteeekirvdiienqvmdfrtqlirlcyssdheklkpqyleelpgqlkqfsmf
lgkfswfagekltfvdfltydildqnrifdpkcldefpnlkafmcrfealekiaaylqsd
qfckmpinnkmaqwgnkpvc

Timeline for d3gtub1:

• d3gtub1 first appeared (with stable ids) in SCOP 1.55
  
• d3gtub1 appears in SCOP 1.63
  
• d3gtub1 appears in SCOP 1.67
  
• d3gtub1 appears in the current release, SCOPe 2.08