| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class mu GST [81348] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries) Uniprot P09488 P28161 |
| Domain d3gtua1: 3gtu A:85-217 [17611] Other proteins in same PDB: d3gtua2, d3gtub2, d3gtuc2, d3gtud2 |
PDB Entry: 3gtu (more details), 2.8 Å
SCOP Domain Sequences for d3gtua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gtua1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk
Timeline for d3gtua1: