SCOPe 2.08: Domain d3fwha1: 3fwh A:2-293

Lineage for d3fwha1 (3fwh A:2-293)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries)

8. Domain d3fwha1: 3fwh A:2-293 [176109]
   Other proteins in same PDB: d3fwha2
   automated match to d1bn6a_
   complexed with act, cl, ipa; mutant

Details for d3fwha1

PDB Entry: 3fwh, 1.22 Å

PDB Description: structure of haloalkane dehalogenase mutant dha15 (i135f/c176y) from rhodococcus rhodochrous

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d3fwha1:

Sequence; same for both SEQRES and ATOM records:

>d3fwha1 c.69.1.8 (A:2-293) automated matches {Rhodococcus sp. [TaxId: 1831]}
seigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrc
iapdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnpe
rvkgiacmefirpfptwdewpefaretfqafrtadvgreliidqnafiegalpkyvvrpl
tevemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwg
tpgvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

Timeline for d3fwha1:

• d3fwha1 first appeared in SCOPe 2.01, called d3fwha_
  
• d3fwha1 appears in SCOPe 2.07