Lineage for d3fwga_ (3fwg A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1743964Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1743965Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries)
    Uniprot P00183
  8. 1743979Domain d3fwga_: 3fwg A: [176107]
    automated match to d1akda_
    complexed with cam, hem, k, trs

Details for d3fwga_

PDB Entry: 3fwg (more details), 1.55 Å

PDB Description: ferric camphor bound cytochrome p450cam, arg365leu, glu366gln, monoclinic crystal form
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d3fwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwga_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarlqiivt
lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d3fwga_:

Click to download the PDB-style file with coordinates for d3fwga_.
(The format of our PDB-style files is described here.)

Timeline for d3fwga_: