![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein automated matches [190064] (21 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188855] (3 PDB entries) |
![]() | Domain d3fwcm_: 3fwc M: [176104] Other proteins in same PDB: d3fwcc_, d3fwcd_, d3fwcg_, d3fwch_, d3fwck_, d3fwcl_, d3fwco_, d3fwcp_ automated match to d2ggma1 protein/RNA complex; complexed with so4 |
PDB Entry: 3fwc (more details), 2.7 Å
SCOPe Domain Sequences for d3fwcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwcm_ a.39.1.5 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydseg rhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltde elramieefdldgdgeinenefiaictd
Timeline for d3fwcm_: