Lineage for d3fwci_ (3fwc I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711206Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188855] (3 PDB entries)
  8. 2711210Domain d3fwci_: 3fwc I: [176103]
    Other proteins in same PDB: d3fwcc_, d3fwcd_, d3fwcg_, d3fwch_, d3fwck_, d3fwcl_, d3fwco_, d3fwcp_
    automated match to d2ggma1
    protein/RNA complex; complexed with so4

Details for d3fwci_

PDB Entry: 3fwc (more details), 2.7 Å

PDB Description: Sac3:Sus1:Cdc31 complex
PDB Compounds: (I:) Cell division control protein 31

SCOPe Domain Sequences for d3fwci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwci_ a.39.1.5 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydseg
rhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltde
elramieefdldgdgeinenefiaict

SCOPe Domain Coordinates for d3fwci_:

Click to download the PDB-style file with coordinates for d3fwci_.
(The format of our PDB-style files is described here.)

Timeline for d3fwci_: