SCOPe 2.01: Domain d3fwba_: 3fwb A:

Lineage for d3fwba_ (3fwb A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188855] (2 PDB entries)

8. Domain d3fwba_: 3fwb A: [176100]
   automated match to d2ggma1
   protein/RNA complex

Details for d3fwba_

PDB Entry: 3fwb, 2.5 Å

PDB Description: Sac3:Sus1:Cdc31 complex

PDB Compounds: (A:) Cell division control protein 31

SCOPe Domain Sequences for d3fwba_:

Sequence; same for both SEQRES and ATOM records:

>d3fwba_ a.39.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsgplnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlidey
dsegrhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelget
ltdeelramieefdldgdgeinenefiaictds

Timeline for d3fwba_:

• d3fwba_ is new in SCOPe 2.01-stable
  
• d3fwba_ appears in SCOPe 2.02
  
• d3fwba_ appears in the current release, SCOPe 2.08