SCOPe 2.06: Domain d3fw5a_: 3fw5 A:

Lineage for d3fw5a_ (3fw5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (39 PDB entries)

8. Domain d3fw5a_: 3fw5 A: [176097]
   automated match to d1ngla_
   complexed with cl, fe, gol, mct, na

Details for d3fw5a_

PDB Entry: 3fw5, 2.3 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with ferric 4-methyl-catechol

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3fw5a_:

Sequence; same for both SEQRES and ATOM records:

>d3fw5a_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d3fw5a_:

• d3fw5a_ first appeared in SCOPe 2.01
  
• d3fw5a_ appears in SCOPe 2.05
  
• d3fw5a_ appears in SCOPe 2.07
  
• d3fw5a_ appears in the current release, SCOPe 2.08