SCOPe 2.05: Domain d3fw4c_: 3fw4 C:

Lineage for d3fw4c_ (3fw4 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (34 PDB entries)

8. Domain d3fw4c_: 3fw4 C: [176096]
   automated match to d1ngla_
   complexed with caq, cl, fe, gol, na

Details for d3fw4c_

PDB Entry: 3fw4, 2.3 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with ferric catechol

PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3fw4c_:

Sequence; same for both SEQRES and ATOM records:

>d3fw4c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d3fw4c_:

• d3fw4c_ first appeared in SCOPe 2.01
  
• d3fw4c_ appears in SCOPe 2.04
  
• d3fw4c_ appears in SCOPe 2.06
  
• d3fw4c_ appears in the current release, SCOPe 2.08