Lineage for d3fw3a_ (3fw3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068582Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (9 PDB entries)
  8. 2068583Domain d3fw3a_: 3fw3 A: [176092]
    automated match to d1znca_
    complexed with ets, glc, so4, zn

Details for d3fw3a_

PDB Entry: 3fw3 (more details), 1.72 Å

PDB Description: Crystal Structure of soluble domain of CA4 in complex with Dorzolamide
PDB Compounds: (A:) Carbonic anhydrase 4

SCOPe Domain Sequences for d3fw3a_:

Sequence, based on SEQRES records: (download)

>d3fw3a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
wcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtwt
vqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhiv
hekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaes
slldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeq
tvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d3fw3a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
wcyevqaessnclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtwtvq
nnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhivhe
kekpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllpkeeklr
hyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdnvrplqq
lgqrtviks

SCOPe Domain Coordinates for d3fw3a_:

Click to download the PDB-style file with coordinates for d3fw3a_.
(The format of our PDB-style files is described here.)

Timeline for d3fw3a_: