Lineage for d3fvub_ (3fvu B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866062Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1866405Protein automated matches [190317] (4 species)
    not a true protein
  7. 1866429Species Human (Homo sapiens) [TaxId:9606] [188901] (7 PDB entries)
  8. 1866437Domain d3fvub_: 3fvu B: [176088]
    automated match to d1w7la_
    complexed with gol, iac, na

Details for d3fvub_

PDB Entry: 3fvu (more details), 1.55 Å

PDB Description: Crystal Structure of Human Kynurenine Aminotransferase I in Complex with Indole-3-acetic Acid
PDB Compounds: (B:) Kynurenine--oxoglutarate transaminase 1

SCOPe Domain Sequences for d3fvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvub_ c.67.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvlntp
nnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltig
sagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqps
syfvqfpqamqrcrdhmirslqsvglkpiipqgsyflitdisdfkrkmpdlpgavdepyd
rrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkvel

SCOPe Domain Coordinates for d3fvub_:

Click to download the PDB-style file with coordinates for d3fvub_.
(The format of our PDB-style files is described here.)

Timeline for d3fvub_: