Lineage for d3fvsa_ (3fvs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131336Protein automated matches [190317] (5 species)
    not a true protein
  7. 2131360Species Human (Homo sapiens) [TaxId:9606] [188901] (8 PDB entries)
  8. 2131363Domain d3fvsa_: 3fvs A: [176084]
    automated match to d1w7la_
    complexed with gol, na

Details for d3fvsa_

PDB Entry: 3fvs (more details), 1.5 Å

PDB Description: Human Kynurenine Aminotransferase I in complex with Glycerol
PDB Compounds: (A:) Kynurenine--oxoglutarate transaminase 1

SCOPe Domain Sequences for d3fvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvsa_ c.67.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvlntp
nnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltig
sagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqps
syfvqfpqamqrcrdhmirslqsvglkpiipqgsyflitdisdfkrkmpdlpgavdepyd
rrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkvel

SCOPe Domain Coordinates for d3fvsa_:

Click to download the PDB-style file with coordinates for d3fvsa_.
(The format of our PDB-style files is described here.)

Timeline for d3fvsa_: