SCOPe 2.08: Domain d3fvsa_: 3fvs A:

Lineage for d3fvsa_ (3fvs A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein automated matches [190317] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188901] (7 PDB entries)

8. Domain d3fvsa_: 3fvs A: [176084]
   automated match to d1w7la_
   complexed with gol, na

Details for d3fvsa_

PDB Entry: 3fvs, 1.5 Å

PDB Description: Human Kynurenine Aminotransferase I in complex with Glycerol

PDB Compounds: (A:) Kynurenine--oxoglutarate transaminase 1

SCOPe Domain Sequences for d3fvsa_:

Sequence; same for both SEQRES and ATOM records:

>d3fvsa_ c.67.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvlntp
nnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltig
sagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqps
syfvqfpqamqrcrdhmirslqsvglkpiipqgsyflitdisdfkrkmpdlpgavdepyd
rrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkvel

Timeline for d3fvsa_:

• d3fvsa_ first appeared in SCOPe 2.01
  
• d3fvsa_ appears in SCOPe 2.07