![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (17 proteins) |
![]() | Protein automated matches [190317] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188901] (7 PDB entries) |
![]() | Domain d3fvsa_: 3fvs A: [176084] automated match to d1w7la_ complexed with gol, na |
PDB Entry: 3fvs (more details), 1.5 Å
SCOPe Domain Sequences for d3fvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fvsa_ c.67.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep ffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvlntp nnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltig sagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqps syfvqfpqamqrcrdhmirslqsvglkpiipqgsyflitdisdfkrkmpdlpgavdepyd rrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkvel
Timeline for d3fvsa_: