SCOPe 2.01: Domain d3fvla_: 3fvl A:

Lineage for d3fvla_ (3fvl A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)

8. Domain d3fvla_: 3fvl A: [176081]
   automated match to d1arla_
   complexed with bhk, zn

Details for d3fvla_

PDB Entry: 3fvl, 1.85 Å

PDB Description: crystallogic studies on the complex of carboxypeptidase a with inhibitors using alpha-hydroxy ketone as zinc-binding group

PDB Compounds: (A:) Carboxypeptidase A1

SCOPe Domain Sequences for d3fvla_:

Sequence; same for both SEQRES and ATOM records:

>d3fvla_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d3fvla_:

• d3fvla_ is new in SCOPe 2.01-stable
  
• d3fvla_ appears in SCOPe 2.02
  
• d3fvla_ appears in the current release, SCOPe 2.08