SCOPe 2.01: Domain d3fvja_: 3fvj A:

Lineage for d3fvja_ (3fvj A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [186957] (8 PDB entries)

8. Domain d3fvja_: 3fvj A: [176080]
   automated match to d1hn4a_
   complexed with ca, cl

Details for d3fvja_

PDB Entry: 3fvj, 2.3 Å

PDB Description: Crystal structure of phospholipase A2 1B crystallized in the presence of octyl sulfate

PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d3fvja_:

Sequence; same for both SEQRES and ATOM records:

>d3fvja_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

Timeline for d3fvja_:

• d3fvja_ is new in SCOPe 2.01-stable
  
• d3fvja_ appears in SCOPe 2.02
  
• d3fvja_ appears in the current release, SCOPe 2.08