| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries) |
| Domain d3fvja_: 3fvj A: [176080] automated match to d1hn4a_ complexed with ca, cl |
PDB Entry: 3fvj (more details), 2.3 Å
SCOPe Domain Sequences for d3fvja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fvja_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc
Timeline for d3fvja_: