SCOP 1.73: Domain d1gtub1: 1gtu B:85-217

Lineage for d1gtub1 (1gtu B:85-217)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)

8. Domain d1gtub1: 1gtu B:85-217 [17608]
   Other proteins in same PDB: d1gtua2, d1gtub2, d1gtuc2, d1gtud2

Details for d1gtub1

PDB Entry: 1gtu, 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1gtub1:

Sequence; same for both SEQRES and ATOM records:

>d1gtub1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d1gtub1:

• d1gtub1 first appeared (with stable ids) in SCOP 1.55
  
• d1gtub1 appears in SCOP 1.71
  
• d1gtub1 appears in SCOP 1.75
  
• d1gtub1 appears in the current release, SCOPe 2.08