Lineage for d1gtua1 (1gtu A:85-217)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270721Protein Class mu GST [81348] (3 species)
  7. 1270729Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
    Uniprot P09488 P28161
  8. 1270755Domain d1gtua1: 1gtu A:85-217 [17607]
    Other proteins in same PDB: d1gtua2, d1gtub2, d1gtuc2, d1gtud2

Details for d1gtua1

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gtua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtua1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d1gtua1:

Click to download the PDB-style file with coordinates for d1gtua1.
(The format of our PDB-style files is described here.)

Timeline for d1gtua1: