Lineage for d2gtub1 (2gtu B:85-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326216Protein Class mu GST [81348] (3 species)
  7. 2326224Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
    Uniprot P09488 P28161
  8. 2326235Domain d2gtub1: 2gtu B:85-217 [17606]
    Other proteins in same PDB: d2gtua2, d2gtub2

Details for d2gtub1

PDB Entry: 2gtu (more details), 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d2gtub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtub1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

SCOPe Domain Coordinates for d2gtub1:

Click to download the PDB-style file with coordinates for d2gtub1.
(The format of our PDB-style files is described here.)

Timeline for d2gtub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtub2