Lineage for d2gtub1 (2gtu B:85-217)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641921Protein Class mu GST [81348] (3 species)
  7. 641929Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
  8. 641950Domain d2gtub1: 2gtu B:85-217 [17606]
    Other proteins in same PDB: d2gtua2, d2gtub2

Details for d2gtub1

PDB Entry: 2gtu (more details), 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form
PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d2gtub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtub1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

SCOP Domain Coordinates for d2gtub1:

Click to download the PDB-style file with coordinates for d2gtub1.
(The format of our PDB-style files is described here.)

Timeline for d2gtub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtub2