Lineage for d2gtub1 (2gtu B:85-217)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3740Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries)
  8. 3743Domain d2gtub1: 2gtu B:85-217 [17606]
    Other proteins in same PDB: d2gtua2, d2gtub2

Details for d2gtub1

PDB Entry: 2gtu (more details), 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d2gtub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtub1 a.45.1.1 (B:85-217) Glutathione S-transferase {Human (Homo sapiens), class mu}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

SCOP Domain Coordinates for d2gtub1:

Click to download the PDB-style file with coordinates for d2gtub1.
(The format of our PDB-style files is described here.)

Timeline for d2gtub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtub2