Lineage for d3ftgb_ (3ftg B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932552Domain d3ftgb_: 3ftg B: [176059]
    automated match to d1bz9b_

Details for d3ftgb_

PDB Entry: 3ftg (more details), 2.6 Å

PDB Description: Crystal Structure of H2Db in complex with NP366-N3A variant peptide from influenza
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3ftgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ftgb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3ftgb_:

Click to download the PDB-style file with coordinates for d3ftgb_.
(The format of our PDB-style files is described here.)

Timeline for d3ftgb_: