Lineage for d3ftbd_ (3ftb D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132418Species Clostridium acetobutylicum [TaxId:1488] [188774] (1 PDB entry)
  8. 2132421Domain d3ftbd_: 3ftb D: [176057]
    automated match to d1lc5a_
    complexed with po4

Details for d3ftbd_

PDB Entry: 3ftb (more details), 2 Å

PDB Description: The crystal structure of the histidinol-phosphate aminotransferase from Clostridium acetobutylicum
PDB Compounds: (D:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3ftbd_:

Sequence, based on SEQRES records: (download)

>d3ftbd_ c.67.1.0 (D:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
lldyssninplgipksflnnidegiknlgvypdvnyrrlnksienylklkdigivlgnga
seiielsislfekiliivpsyaeyeinakkhgvsvvfsyldenmcidyediiskiddvds
viignpnnpngglinkekfihvlklaeekkktiiideafieftgdpsssfvgeiknyscl
fiiramtkffampgirfgygitnnkeiaakikakqnpwnincfaemaainclkdtnyiee
sllwikkerkrfieelnkigfikrvfsphanfvlcrlenisgeklydsllkedivirrcc
nfiglddsfvrfaikdekkntkflralkgvennl

Sequence, based on observed residues (ATOM records): (download)

>d3ftbd_ c.67.1.0 (D:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
lldyssninplgipksflnnidegiknlgvypdvnyrrlnksienylklkdigivlgnga
seiielsislfekiliivpsyaeyeinakkhgvsvvfsyldenmcidyediiskiddvds
viignpnnpngglinkekfihvlklaeekktiiideafieftgdpsssfvgeiknysclf
iiramtkffampgirfgygitnnkeiaakikakqnpwnincfaemaainclkdtnyiees
llwikkerkrfieelnkigfikrvfsphanfvlcrlenisgeklydsllkedivirrccn
figlddsfvrfaikdekkntkflralkgvennl

SCOPe Domain Coordinates for d3ftbd_:

Click to download the PDB-style file with coordinates for d3ftbd_.
(The format of our PDB-style files is described here.)

Timeline for d3ftbd_: