Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.3: PHL pollen allergen [49590] (2 families) |
Family b.7.3.0: automated matches [191612] (1 protein) not a true family |
Protein automated matches [191118] (2 species) not a true protein |
Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries) |
Domain d3ft9a_: 3ft9 A: [176054] automated match to d1bmwa_ |
PDB Entry: 3ft9 (more details), 2.05 Å
SCOPe Domain Sequences for d3ft9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ft9a_ b.7.3.0 (A:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]} vqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskpl vgpfnfrfmskggmrnvfdeviptafsigktykp
Timeline for d3ft9a_: