Lineage for d3ft9a_ (3ft9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773255Superfamily b.7.3: PHL pollen allergen [49590] (2 families) (S)
  5. 2773269Family b.7.3.0: automated matches [191612] (1 protein)
    not a true family
  6. 2773270Protein automated matches [191118] (2 species)
    not a true protein
  7. 2773273Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries)
  8. 2773278Domain d3ft9a_: 3ft9 A: [176054]
    automated match to d1bmwa_

Details for d3ft9a_

PDB Entry: 3ft9 (more details), 2.05 Å

PDB Description: X-ray Crystal structure of pollen allergen - Phl p 3
PDB Compounds: (A:) Phl p 3 allergen

SCOPe Domain Sequences for d3ft9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ft9a_ b.7.3.0 (A:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
vqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskpl
vgpfnfrfmskggmrnvfdeviptafsigktykp

SCOPe Domain Coordinates for d3ft9a_:

Click to download the PDB-style file with coordinates for d3ft9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ft9a_: