Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class mu GST [81348] (3 species) |
Domain d2gtua1: 2gtu A:85-217 [17605] Other proteins in same PDB: d2gtua2, d2gtub2 |
PDB Entry: 2gtu (more details), 2.55 Å
SCOPe Domain Sequences for d2gtua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtua1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp rpvftkmavwgnk
Timeline for d2gtua1: