| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.3: PHL pollen allergen [49590] (2 families) ![]() |
| Family b.7.3.0: automated matches [191612] (1 protein) not a true family |
| Protein automated matches [191118] (2 species) not a true protein |
| Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries) |
| Domain d3ft1c1: 3ft1 C:1-97 [176049] Other proteins in same PDB: d3ft1a2, d3ft1b2, d3ft1c2, d3ft1d2 automated match to d1bmwa_ complexed with cl |
PDB Entry: 3ft1 (more details), 1.79 Å
SCOPe Domain Sequences for d3ft1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ft1c1 b.7.3.0 (C:1-97) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
avqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskp
lvgpfnfrfmskggmrnvfdeviptafsigktykpee
Timeline for d3ft1c1: