Lineage for d3ft1b_ (3ft1 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941314Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 941530Superfamily b.7.3: PHL pollen allergen [49590] (2 families) (S)
  5. 941544Family b.7.3.0: automated matches [191612] (1 protein)
    not a true family
  6. 941545Protein automated matches [191118] (1 species)
    not a true protein
  7. 941546Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (2 PDB entries)
  8. 941548Domain d3ft1b_: 3ft1 B: [176048]
    automated match to d1bmwa_
    complexed with cl

Details for d3ft1b_

PDB Entry: 3ft1 (more details), 1.79 Å

PDB Description: Crystal structure of pollen allergen Phl p 3
PDB Compounds: (B:) Phl p 3 allergen

SCOPe Domain Sequences for d3ft1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ft1b_ b.7.3.0 (B:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
avqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskp
lvgpfnfrfmskggmrnvfdeviptafsigktykpeeqef

SCOPe Domain Coordinates for d3ft1b_:

Click to download the PDB-style file with coordinates for d3ft1b_.
(The format of our PDB-style files is described here.)

Timeline for d3ft1b_: