Lineage for d3ft1b1 (3ft1 B:1-97)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773255Superfamily b.7.3: PHL pollen allergen [49590] (2 families) (S)
  5. 2773269Family b.7.3.0: automated matches [191612] (1 protein)
    not a true family
  6. 2773270Protein automated matches [191118] (2 species)
    not a true protein
  7. 2773273Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries)
  8. 2773275Domain d3ft1b1: 3ft1 B:1-97 [176048]
    Other proteins in same PDB: d3ft1a2, d3ft1b2, d3ft1c2, d3ft1d2
    automated match to d1bmwa_
    complexed with cl

Details for d3ft1b1

PDB Entry: 3ft1 (more details), 1.79 Å

PDB Description: Crystal structure of pollen allergen Phl p 3
PDB Compounds: (B:) Phl p 3 allergen

SCOPe Domain Sequences for d3ft1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ft1b1 b.7.3.0 (B:1-97) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
avqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskp
lvgpfnfrfmskggmrnvfdeviptafsigktykpee

SCOPe Domain Coordinates for d3ft1b1:

Click to download the PDB-style file with coordinates for d3ft1b1.
(The format of our PDB-style files is described here.)

Timeline for d3ft1b1: