SCOPe 2.07: Domain d3ft1a1: 3ft1 A:1-97

Lineage for d3ft1a1 (3ft1 A:1-97)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.3: PHL pollen allergen [49590] (2 families)

5. Family b.7.3.0: automated matches [191612] (1 protein)
   not a true family

6. Protein automated matches [191118] (2 species)
   not a true protein

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries)

8. Domain d3ft1a1: 3ft1 A:1-97 [176047]
   Other proteins in same PDB: d3ft1a2, d3ft1b2, d3ft1c2, d3ft1d2
   automated match to d1bmwa_
   complexed with cl

Details for d3ft1a1

PDB Entry: 3ft1, 1.79 Å

PDB Description: Crystal structure of pollen allergen Phl p 3

PDB Compounds: (A:) Phl p 3 allergen

SCOPe Domain Sequences for d3ft1a1:

Sequence; same for both SEQRES and ATOM records:

>d3ft1a1 b.7.3.0 (A:1-97) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
avqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskp
lvgpfnfrfmskggmrnvfdeviptafsigktykpee

Timeline for d3ft1a1:

• d3ft1a1 first appeared in SCOPe 2.01, called d3ft1a_
  
• d3ft1a1 appears in SCOPe 2.06
  
• d3ft1a1 appears in the current release, SCOPe 2.08