SCOPe 2.05: Domain d3ft1a_: 3ft1 A:

Lineage for d3ft1a_ (3ft1 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.3: PHL pollen allergen [49590] (2 families)

5. Family b.7.3.0: automated matches [191612] (1 protein)
   not a true family

6. Protein automated matches [191118] (2 species)
   not a true protein

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries)

8. Domain d3ft1a_: 3ft1 A: [176047]
   automated match to d1bmwa_
   complexed with cl

Details for d3ft1a_

PDB Entry: 3ft1, 1.79 Å

PDB Description: Crystal structure of pollen allergen Phl p 3

PDB Compounds: (A:) Phl p 3 allergen

SCOPe Domain Sequences for d3ft1a_:

Sequence; same for both SEQRES and ATOM records:

>d3ft1a_ b.7.3.0 (A:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
avqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskp
lvgpfnfrfmskggmrnvfdeviptafsigktykpeeqef

Timeline for d3ft1a_:

• d3ft1a_ first appeared in SCOPe 2.01
  
• d3ft1a_ appears in SCOPe 2.04
  
• d3ft1a_ is called d3ft1a1 in SCOPe 2.06
  
• d3ft1a_ appears in the current release, SCOPe 2.08, called d3ft1a1