SCOPe 2.06: Domain d1hnaa1: 1hna A:85-217

Lineage for d1hnaa1 (1hna A:85-217)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (16 PDB entries)
   Uniprot P09488 P28161

8. Domain d1hnaa1: 1hna A:85-217 [17604]
   Other proteins in same PDB: d1hnaa2
   complexed with gdn

Details for d1hnaa1

PDB Entry: 1hna, 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1hnaa1:

Sequence; same for both SEQRES and ATOM records:

>d1hnaa1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

Timeline for d1hnaa1:

• d1hnaa1 first appeared (with stable ids) in SCOP 1.55, called d1hna_1
  
• d1hnaa1 appears in SCOPe 2.05
  
• d1hnaa1 appears in SCOPe 2.07
  
• d1hnaa1 appears in the current release, SCOPe 2.08