Lineage for d1hna_1 (1hna 85-217)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443530Protein Class mu GST [81348] (3 species)
  7. 443538Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries)
  8. 443539Domain d1hna_1: 1hna 85-217 [17604]
    Other proteins in same PDB: d1hna_2

Details for d1hna_1

PDB Entry: 1hna (more details), 1.85 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hna_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hna_1 a.45.1.1 (85-217) Class mu GST {Human (Homo sapiens)}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOP Domain Coordinates for d1hna_1:

Click to download the PDB-style file with coordinates for d1hna_1.
(The format of our PDB-style files is described here.)

Timeline for d1hna_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hna_2