SCOPe 2.01: Domain d3fsob_: 3fso B:

Lineage for d3fsob_ (3fso B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.0: automated matches [191575] (1 protein)
   not a true family

6. Protein automated matches [191010] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188932] (3 PDB entries)

8. Domain d3fsob_: 3fso B: [176037]
   automated match to d2fwsa1

Details for d3fsob_

PDB Entry: 3fso, 1.41 Å

PDB Description: Crystal structure of the Calx-beta domain of integrin beta4, calcium soak

PDB Compounds: (B:) Integrin beta-4

SCOPe Domain Sequences for d3fsob_:

Sequence, based on SEQRES records:

>d3fsob_ b.1.27.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegell
fqpgeawkelqvkllelqevdsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdpd

Sequence, based on observed residues (ATOM records):

>d3fsob_ b.1.27.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegell
fqpgeawkelqvkllellrgrqvrrfhvqlsnpkfgahlgqphsttiiirdpd

Timeline for d3fsob_:

• d3fsob_ is new in SCOPe 2.01-stable
  
• d3fsob_ appears in SCOPe 2.02
  
• d3fsob_ appears in the current release, SCOPe 2.08, called d3fsob1