Lineage for d3fsoa1 (3fso A:989-1105)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2039949Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2039965Family b.1.27.0: automated matches [191575] (1 protein)
    not a true family
  6. 2039966Protein automated matches [191010] (2 species)
    not a true protein
  7. 2039977Species Human (Homo sapiens) [TaxId:9606] [188932] (3 PDB entries)
  8. 2039978Domain d3fsoa1: 3fso A:989-1105 [176036]
    Other proteins in same PDB: d3fsoa2, d3fsob2
    automated match to d2fwsa1

Details for d3fsoa1

PDB Entry: 3fso (more details), 1.41 Å

PDB Description: Crystal structure of the Calx-beta domain of integrin beta4, calcium soak
PDB Compounds: (A:) Integrin beta-4

SCOPe Domain Sequences for d3fsoa1:

Sequence, based on SEQRES records: (download)

>d3fsoa1 b.1.27.0 (A:989-1105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf
qpgeawkelqvkllelqevdsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdp

Sequence, based on observed residues (ATOM records): (download)

>d3fsoa1 b.1.27.0 (A:989-1105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf
qpgeawkelqvkllelrqvrrfhvqlsnpkfgahlgqphsttiiirdp

SCOPe Domain Coordinates for d3fsoa1:

Click to download the PDB-style file with coordinates for d3fsoa1.
(The format of our PDB-style files is described here.)

Timeline for d3fsoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fsoa2