![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.27: CalX-like [141072] (2 families) ![]() |
![]() | Family b.1.27.0: automated matches [191575] (1 protein) not a true family |
![]() | Protein automated matches [191010] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188932] (3 PDB entries) |
![]() | Domain d3fsoa1: 3fso A:989-1105 [176036] Other proteins in same PDB: d3fsoa2, d3fsob2 automated match to d2fwsa1 |
PDB Entry: 3fso (more details), 1.41 Å
SCOPe Domain Sequences for d3fsoa1:
Sequence, based on SEQRES records: (download)
>d3fsoa1 b.1.27.0 (A:989-1105) automated matches {Human (Homo sapiens) [TaxId: 9606]} rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf qpgeawkelqvkllelqevdsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdp
>d3fsoa1 b.1.27.0 (A:989-1105) automated matches {Human (Homo sapiens) [TaxId: 9606]} rdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegellf qpgeawkelqvkllelrqvrrfhvqlsnpkfgahlgqphsttiiirdp
Timeline for d3fsoa1: