Lineage for d3fslc_ (3fsl C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895181Protein Aromatic aminoacid aminotransferase, AroAT [53392] (4 species)
  7. 2895182Species Escherichia coli K-12 [TaxId:83333] [188771] (1 PDB entry)
  8. 2895185Domain d3fslc_: 3fsl C: [176032]
    automated match to d3tata_
    complexed with plr; mutant

Details for d3fslc_

PDB Entry: 3fsl (more details), 2.35 Å

PDB Description: crystal structure of tyrosine aminotransferase tripple mutant (p181q, r183g,a321k) from escherichia coli at 2.35 a resolution
PDB Compounds: (C:) Aromatic-amino-acid aminotransferase

SCOPe Domain Sequences for d3fslc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fslc_ c.67.1.1 (C:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli K-12 [TaxId: 83333]}
mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlqagsivllhp
cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
dealkaswlkeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
rlreefgvyliasgrmcvaglntanvqrvakafaavm

SCOPe Domain Coordinates for d3fslc_:

Click to download the PDB-style file with coordinates for d3fslc_.
(The format of our PDB-style files is described here.)

Timeline for d3fslc_: