Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein automated matches [190211] (5 species) not a true protein |
Species Moloney murine leukemia virus [TaxId:11801] [188900] (1 PDB entry) |
Domain d3fsia_: 3fsi A: [176028] automated match to d1d0ea_ protein/DNA complex; complexed with act, mwb |
PDB Entry: 3fsi (more details), 1.75 Å
SCOPe Domain Sequences for d3fsia_:
Sequence, based on SEQRES records: (download)
>d3fsia_ e.8.1.2 (A:) automated matches {Moloney murine leukemia virus [TaxId: 11801]} twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq kqvkylgyllkegqr
>d3fsia_ e.8.1.2 (A:) automated matches {Moloney murine leukemia virus [TaxId: 11801]} twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld qgilvpcqspwntpllpvyrpvqdlrevnkrvedihptvpnpynllsglppshqwytvld lkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdealhrdladf riqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicqkqvkylg yllkegqr
Timeline for d3fsia_: