Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188773] (1 PDB entry) |
Domain d3fshb1: 3fsh B:1-165 [176027] Other proteins in same PDB: d3fsha2, d3fshb2 automated match to d2ucza_ |
PDB Entry: 3fsh (more details), 2.76 Å
SCOPe Domain Sequences for d3fshb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fshb1 d.20.1.1 (B:1-165) automated matches {Mouse (Mus musculus) [TaxId: 10090]} magtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsf pldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekil lsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
Timeline for d3fshb1: