Lineage for d3fshb_ (3fsh B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021744Protein automated matches [190124] (8 species)
    not a true protein
  7. 1021793Species Mouse (Mus musculus) [TaxId:10090] [188773] (1 PDB entry)
  8. 1021795Domain d3fshb_: 3fsh B: [176027]
    automated match to d2ucza_

Details for d3fshb_

PDB Entry: 3fsh (more details), 2.76 Å

PDB Description: Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d3fshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fshb_ d.20.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
shmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpail
sfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvek
illsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

SCOPe Domain Coordinates for d3fshb_:

Click to download the PDB-style file with coordinates for d3fshb_.
(The format of our PDB-style files is described here.)

Timeline for d3fshb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fsha_