SCOPe 2.08: Domain d3fshb1: 3fsh B:1-165

Lineage for d3fshb1 (3fsh B:1-165)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188773] (1 PDB entry)

8. Domain d3fshb1: 3fsh B:1-165 [176027]
   Other proteins in same PDB: d3fsha2, d3fshb2
   automated match to d2ucza_

Details for d3fshb1

PDB Entry: 3fsh, 2.76 Å

PDB Description: Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d3fshb1:

Sequence; same for both SEQRES and ATOM records:

>d3fshb1 d.20.1.1 (B:1-165) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
magtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsf
pldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekil
lsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

Timeline for d3fshb1:

• d3fshb1 first appeared in SCOPe 2.01, called d3fshb_
  
• d3fshb1 appears in SCOPe 2.07