Lineage for d3fshb1 (3fsh B:1-165)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939372Species Mouse (Mus musculus) [TaxId:10090] [188773] (1 PDB entry)
  8. 2939374Domain d3fshb1: 3fsh B:1-165 [176027]
    Other proteins in same PDB: d3fsha2, d3fshb2
    automated match to d2ucza_

Details for d3fshb1

PDB Entry: 3fsh (more details), 2.76 Å

PDB Description: Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d3fshb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fshb1 d.20.1.1 (B:1-165) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
magtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsf
pldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekil
lsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

SCOPe Domain Coordinates for d3fshb1:

Click to download the PDB-style file with coordinates for d3fshb1.
(The format of our PDB-style files is described here.)

Timeline for d3fshb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fshb2