Lineage for d3fs7h_ (3fs7 H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710476Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2710482Protein Parvalbumin [47495] (9 species)
  7. 2710492Species Chicken (Gallus gallus) [TaxId:9031] [224839] (2 PDB entries)
  8. 2710500Domain d3fs7h_: 3fs7 H: [176021]
    automated match to d1rtp1_
    complexed with ca, gol, so4

Details for d3fs7h_

PDB Entry: 3fs7 (more details), 1.95 Å

PDB Description: crystal structure of gallus gallus beta-parvalbumin (avian thymic hormone)
PDB Compounds: (H:) Parvalbumin, thymic

SCOPe Domain Sequences for d3fs7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fs7h_ a.39.1.4 (H:) Parvalbumin {Chicken (Gallus gallus) [TaxId: 9031]}
aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka

SCOPe Domain Coordinates for d3fs7h_:

Click to download the PDB-style file with coordinates for d3fs7h_.
(The format of our PDB-style files is described here.)

Timeline for d3fs7h_: