![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries) |
![]() | Domain d1gtie1: 1gti E:79-209 [17602] Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2 complexed with gtb |
PDB Entry: 1gti (more details), 3 Å
SCOPe Domain Sequences for d1gtie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtie1 a.45.1.1 (E:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]} ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh vnrpingngkq
Timeline for d1gtie1: