Lineage for d3fs4d_ (3fs4 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688807Species Struthio camelus [TaxId:8801] [188835] (1 PDB entry)
  8. 2688811Domain d3fs4d_: 3fs4 D: [176012]
    automated match to d1fawb_
    complexed with hem, oxy

Details for d3fs4d_

PDB Entry: 3fs4 (more details), 2.22 Å

PDB Description: crystal structure determination of ostrich hemoglobin at 2.2 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3fs4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fs4d_ a.1.1.2 (D:) automated matches {Struthio camelus [TaxId: 8801]}
vqwsaeekqlisglwgkvnvadcgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahftk
eftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d3fs4d_:

Click to download the PDB-style file with coordinates for d3fs4d_.
(The format of our PDB-style files is described here.)

Timeline for d3fs4d_: