SCOPe 2.01: Domain d3froc_: 3fro C:

Lineage for d3froc_ (3fro C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families)

5. Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
   Pfam PF00534

6. Protein automated matches [190508] (1 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)

8. Domain d3froc_: 3fro C: [176006]
   automated match to d2bisa1
   complexed with nhf, po4, trs

Details for d3froc_

PDB Entry: 3fro, 2.5 Å

PDB Description: crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations

PDB Compounds: (C:) glga glycogen synthase

SCOPe Domain Sequences for d3froc_:

Sequence; same for both SEQRES and ATOM records:

>d3froc_ c.87.1.8 (C:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
rhmkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfg
eevqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllree
plpdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdid
pehtggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkk
sllskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpeleg
warsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipias
avgglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksa
eryvkaytgsidrafdfil

Timeline for d3froc_:

• d3froc_ is new in SCOPe 2.01-stable
  
• d3froc_ appears in SCOPe 2.02
  
• d3froc_ appears in the current release, SCOPe 2.08, called d3froc1