Lineage for d3frob_ (3fro B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007198Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1007199Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1007536Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 1007553Protein automated matches [190508] (1 species)
    not a true protein
  7. 1007554Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)
  8. 1007556Domain d3frob_: 3fro B: [176005]
    automated match to d2bisa1
    complexed with nhf, po4, trs

Details for d3frob_

PDB Entry: 3fro (more details), 2.5 Å

PDB Description: crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations
PDB Compounds: (B:) glga glycogen synthase

SCOPe Domain Sequences for d3frob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frob_ c.87.1.8 (B:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
rhmkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfg
eevqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllree
plpdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdid
pehtggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkk
sllskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpeleg
warsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipias
avgglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksa
eryvkaytgsidrafdfil

SCOPe Domain Coordinates for d3frob_:

Click to download the PDB-style file with coordinates for d3frob_.
(The format of our PDB-style files is described here.)

Timeline for d3frob_: