SCOPe 2.08: Domain d3frob1: 3fro B:1-437

Lineage for d3frob1 (3fro B:1-437)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
   Pfam PF00534

6. Protein automated matches [190508] (1 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)

8. Domain d3frob1: 3fro B:1-437 [176005]
   Other proteins in same PDB: d3froa2, d3frob2, d3froc2
   automated match to d2bisa1
   complexed with nhf, po4, trs

Details for d3frob1

PDB Entry: 3fro, 2.5 Å

PDB Description: crystal structure of pyrococcus abyssi glycogen synthase with open and closed conformations

PDB Compounds: (B:) glga glycogen synthase

SCOPe Domain Sequences for d3frob1:

Sequence; same for both SEQRES and ATOM records:

>d3frob1 c.87.1.8 (B:1-437) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfgee
vqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllreepl
pdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdidpe
htggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkksl
lskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpelegwa
rsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipiasav
gglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksaer
yvkaytgsidrafdfil

Timeline for d3frob1:

• d3frob1 first appeared in SCOPe 2.01, called d3frob_
  
• d3frob1 appears in SCOPe 2.07