| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries) Uniprot P28845 |
| Domain d3frjb1: 3frj B:24-284 [176003] Other proteins in same PDB: d3frja2, d3frjb2 automated match to d1xu9a_ complexed with a49, nap |
PDB Entry: 3frj (more details), 2.3 Å
SCOPe Domain Sequences for d3frjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3frjb1 c.2.1.2 (B:24-284) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslw
ttllirnpsrkileflystsy
Timeline for d3frjb1: