Lineage for d3frjb1 (3frj B:24-284)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841402Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2841418Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
    Uniprot P28845
  8. 2841444Domain d3frjb1: 3frj B:24-284 [176003]
    Other proteins in same PDB: d3frja2, d3frjb2
    automated match to d1xu9a_
    complexed with a49, nap

Details for d3frjb1

PDB Entry: 3frj (more details), 2.3 Å

PDB Description: crystal structure of 11b-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with piperidyl benzamide inhibitor
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOPe Domain Sequences for d3frjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frjb1 c.2.1.2 (B:24-284) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslw
ttllirnpsrkileflystsy

SCOPe Domain Coordinates for d3frjb1:

Click to download the PDB-style file with coordinates for d3frjb1.
(The format of our PDB-style files is described here.)

Timeline for d3frjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3frjb2