Lineage for d3frdx_ (3frd X:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871800Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 1871932Species Staphylococcus aureus [TaxId:1280] [188976] (21 PDB entries)
  8. 1871947Domain d3frdx_: 3frd X: [175998]
    automated match to d1dhja_
    complexed with dhf, ndp

Details for d3frdx_

PDB Entry: 3frd (more details), 2.1 Å

PDB Description: S. aureus DHFR complexed with NADPH and folate
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3frdx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frdx_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3frdx_:

Click to download the PDB-style file with coordinates for d3frdx_.
(The format of our PDB-style files is described here.)

Timeline for d3frdx_: